| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335043.1 | 3prime_partial | 202 | 225-830(+) |
Amino Acid sequence : | |||
| MVALVPREAALFAAGAVAGAAAKTVTAPLDRIKLLMQTHGIRAGQVGAKKGIGFIEAFTLIGKEEGLKGYWKGNLPQVIRIIPYSAVQLFAYETYKKLFQGKDGELSVIGRLAAGACAGM TSTFVTYPLDVLRLRLAVETGHRTMSQVALTMLREEGFASFYNGLGPSLIGIAPYIAVNFCVFDLVKKALPEKYQKRTEASM | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 12,192.886 | ||
| Theoretical pI: | 8.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 58.134 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.336 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335043.1 | 3prime_partial | 113 | 341-3(-) |
Amino Acid sequence : | |||
| MSLHKKLNAVERRGDSFSGGAGNCPGGEESGFSRNQCNHSQWMLQKLIEGGEELLLVPLLGERNTRKIMPSTIGAPKEAPGLTLVEGGGMVGAEAGNLRPCQCRWRIISHLPR | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,192.886 | ||
| Theoretical pI: | 8.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 58.134 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.336 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335043.1 | 3prime_partial | 202 | 225-830(+) |
Amino Acid sequence : | |||
| MVALVPREAALFAAGAVAGAAAKTVTAPLDRIKLLMQTHGIRAGQVGAKKGIGFIEAFTLIGKEEGLKGYWKGNLPQVIRIIPYSAVQLFAYETYKKLFQGKDGELSVIGRLAAGACAGM TSTFVTYPLDVLRLRLAVETGHRTMSQVALTMLREEGFASFYNGLGPSLIGIAPYIAVNFCVFDLVKKALPEKYQKRTEASM | |||
Physicochemical properties | |||
| Number of amino acids: | 202 | ||
| Molecular weight: | 12,192.886 | ||
| Theoretical pI: | 8.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 58.134 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.336 | ||
| sheet | 0.292 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335043.1 | 3prime_partial | 113 | 341-3(-) |
Amino Acid sequence : | |||
| MSLHKKLNAVERRGDSFSGGAGNCPGGEESGFSRNQCNHSQWMLQKLIEGGEELLLVPLLGERNTRKIMPSTIGAPKEAPGLTLVEGGGMVGAEAGNLRPCQCRWRIISHLPR | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 12,192.886 | ||
| Theoretical pI: | 8.858 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11250 | ||
| Instability index: | 58.134 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.431 | ||
Secondary Structure Fraction | |||
| Helix | 0.230 | ||
| turn | 0.336 | ||
| sheet | 0.292 | ||