Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335048.1 | 5prime_partial | 174 | 1-525(+) |
Amino Acid sequence : | |||
RFIFIIISVFFTELVNSQLTLEETTNKGVVLALYEALSSHDVVQVQKLLASDLEWWFHGPPSHQFLMQILTGTAKFDNASFQFLHKTIDVFGSVVLVEGCDPTRSITWVHAWTVTDGVIT QVREYFNTSLTVTRFRKKNQSDISSITPLHCPSVWESSLPNRVGKSVPGLVLAL* | |||
Physicochemical properties | |||
Number of amino acids: | 174 | ||
Molecular weight: | 19,580.237 | ||
Theoretical pI: | 6.308 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30605 | ||
Instability index: | 23.397 | ||
aromaticity | 0.109 | ||
GRAVY | 0.190 | ||
Secondary Structure Fraction | |||
Helix | 0.391 | ||
turn | 0.218 | ||
sheet | 0.201 |