| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335058.1 | internal | 206 | 620-3(-) |
Amino Acid sequence : | |||
| LHNFPCEIGVVSPEMPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVDKHRQRLRHTDGVRDLHDAPPSDPVGNDALGRLPDDVGATPVDLGGVLPGEGPATV GAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDQWGXLMGPRAEF | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,587.422 | ||
| Theoretical pI: | 8.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 16.263 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.254 | ||
| sheet | 0.166 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335058.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| EFGTRPHQXSPLILISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGV ARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTAAYGHFWRDDPDFTWEVVK | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,587.422 | ||
| Theoretical pI: | 8.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 16.263 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.254 | ||
| sheet | 0.166 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335058.1 | internal | 206 | 620-3(-) |
Amino Acid sequence : | |||
| LHNFPCEIGVVSPEMPVRRGLQEPPVAPPLQVEVDRDHPRPEVEALLHDLQDLLVGDLPRPVGVDKHRQRLRHTDGVRDLHDAPPSDPVGNDALGRLPDDVGATPVDLGGVLPGEGPATV GAPPAVGVDDDLTAGETRIAVGPTDDETPGGVKVEDGLLVQVLLGDDWLDDVLLEIPRDLVVGDGLVVLGRDEDQWGXLMGPRAEF | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,587.422 | ||
| Theoretical pI: | 8.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 16.263 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.254 | ||
| sheet | 0.166 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335058.1 | internal | 206 | 3-620(+) |
Amino Acid sequence : | |||
| EFGTRPHQXSPLILISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAHGGGAFSGKDPTKVDRSGAYIVRQAAKSIVANGV ARRCIVQVSYAIGVPEPLSVFVDSYGTGKIPDKEILKIVKESFDFRPGMISINLDLKRGSNGRFLKTAAYGHFWRDDPDFTWEVVK | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 22,587.422 | ||
| Theoretical pI: | 8.614 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
| Instability index: | 16.263 | ||
| aromaticity | 0.093 | ||
| GRAVY | -0.300 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.254 | ||
| sheet | 0.166 | ||