Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335068.1 | 5prime_partial | 206 | 3-623(+) |
Amino Acid sequence : | |||
SASIGYIGVGTVEFLLDERGSFYFMEMNTRIQVEHPVTEMISSVDLIEEQIRVAQGEKLRYTQDDIVLRGHSIECRINAEDAFKNFRPGPGRITSYLPAGGPFVRMDSHVYPDYVVPPSY DSLLGKLIVWAPTRERAIERMKRALSDTIITGVPTTIDYHKLILEVEDFKTGKVDTAFIPKHEEELAAPLPIQRASTEKELVNASS* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 13,412.397 | ||
Theoretical pI: | 9.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48845 | ||
Instability index: | 69.627 | ||
aromaticity | 0.158 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.272 | ||
sheet | 0.149 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335068.1 | complete | 114 | 482-138(-) |
Amino Acid sequence : | |||
MVINCRWNSCYNGVTKSPLHALDCPFPCWSPDNKLSKKGIIAWWNHIIWVNVAVHSHKWTSRWQIRSYSPWSRSEIFESIFCINTAFYRMSSKHNIVLCVAKFLALSNTDLFFN* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 13,412.397 | ||
Theoretical pI: | 9.353 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48470 48845 | ||
Instability index: | 69.627 | ||
aromaticity | 0.158 | ||
GRAVY | -0.048 | ||
Secondary Structure Fraction | |||
Helix | 0.368 | ||
turn | 0.272 | ||
sheet | 0.149 |