| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335070.1 | 5prime_partial | 219 | 3-662(+) |
Amino Acid sequence : | |||
| RRNFCCASMEVETTAISAIVAKAEELVQSAMKGNDASHDAAHAFRVRDLALSLAREEGLSASRSSMLILELAALLHDIGDYKYMRDPSEGKIVENFLVQEGFKEEIGGLTGRSHCPEFGV VQDADRLDAIGAIGIARCFTFGGSRNRVLHDPQIKPRSDLSKDKYMNKDEQTTVNHFHEKLLKLKELMKTKAGKRRAEKKHKFMEEFLEEFYQEWDGRA* | |||
Physicochemical properties | |||
| Number of amino acids: | 219 | ||
| Molecular weight: | 11,471.688 | ||
| Theoretical pI: | 9.193 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 48.373 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.416 | ||
| turn | 0.178 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335070.1 | complete | 101 | 530-225(-) |
Amino Acid sequence : | |||
| MVHCCLLVFIHVLVLGQIGSRLYLGIVQHPVPASTKRKATCDPYSTDCIEAICILYHPKFRTVTSPCKPTNFLLEAFLHKKVLDNLPFRRISHILVVPYIV* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 11,471.688 | ||
| Theoretical pI: | 9.193 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 48.373 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.416 | ||
| turn | 0.178 | ||
| sheet | 0.198 | ||