Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | internal | 260 | 781-2(-) |
Amino Acid sequence : | |||
RPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMA AVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIAL ADYIAYRDYKGIFYYFLIIS | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
LILLRNNKIYPYNLCKQYNRREQSRGQPCADQSEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPPPEPPT PAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | 3prime_partial | 126 | 404-781(+) |
Amino Acid sequence : | |||
MIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTSR DAKDRP | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | internal | 260 | 781-2(-) |
Amino Acid sequence : | |||
RPILCITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMA AVGLDHLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIAL ADYIAYRDYKGIFYYFLIIS | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | 5prime_partial | 146 | 1-441(+) |
Amino Acid sequence : | |||
LILLRNNKIYPYNLCKQYNRREQSRGQPCADQSEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPPPEPPT PAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
Number of amino acids: | 146 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335081.1 | 3prime_partial | 126 | 404-781(+) |
Amino Acid sequence : | |||
MIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTSR DAKDRP | |||
Physicochemical properties | |||
Number of amino acids: | 126 | ||
Molecular weight: | 14,289.013 | ||
Theoretical pI: | 11.733 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 60.266 | ||
aromaticity | 0.016 | ||
GRAVY | -0.889 | ||
Secondary Structure Fraction | |||
Helix | 0.230 | ||
turn | 0.214 | ||
sheet | 0.214 |