Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335087.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
HAVSCRIRHEETIQTQNRAKKSGKMGLSDDQVSSMKEAFNLFDADSDGKIAPSELGILMRSLGGNPTQAQLKAIIAEEKLTAPFDFQRFLDLMSKHLKPEPFDRQLRDAFKVLDKEGTGY VVVKELRHILTSIGEKLEPAEFDEWIREVDVGSDGKILYEDFIARMVAK* | |||
Physicochemical properties | |||
Number of amino acids: | 169 | ||
Molecular weight: | 19,080.579 | ||
Theoretical pI: | 5.640 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 36.416 | ||
aromaticity | 0.071 | ||
GRAVY | -0.441 | ||
Secondary Structure Fraction | |||
Helix | 0.284 | ||
turn | 0.183 | ||
sheet | 0.290 |