| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335093.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TPYMDISLSTEQLLHPQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVV LDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTDKLSYI GGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 28,042.001 | ||
| Theoretical pI: | 6.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 43.137 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.228 | ||
| sheet | 0.272 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335093.1 | internal | 250 | 3-752(+) |
Amino Acid sequence : | |||
| TPYMDISLSTEQLLHPQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVV LDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAMSCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAIVEAVPTMKCTVLDLPHVVAGLESTDKLSYI GGDMFQSIPS | |||
Physicochemical properties | |||
| Number of amino acids: | 250 | ||
| Molecular weight: | 28,042.001 | ||
| Theoretical pI: | 6.282 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 43.137 | ||
| aromaticity | 0.088 | ||
| GRAVY | -0.105 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.228 | ||
| sheet | 0.272 | ||