Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335101.1 | 5prime_partial | 127 | 3-386(+) |
Amino Acid sequence : | |||
TSYHLSLSLSCRASISLNMASSSQNGIQLLLAAEQEAQHIVNAARSAKQARLKQAKEEAEKEIAEFRAQMEAEYQRKVAESSGDSGANVKRLEQETQAKIHHLKTEASRISPDVVAMLLR HVTTVKN* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 11,510.242 | ||
Theoretical pI: | 5.848 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 46.928 | ||
aromaticity | 0.107 | ||
GRAVY | 0.482 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.252 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335101.1 | complete | 103 | 404-93(-) |
Amino Acid sequence : | |||
MGPYQDLVLDCSHVPQKHGDDVRRDSGSLGLQVMDLCLGFLFEALHIRTRISTTLGHLPLIFSLHLSAEFSNFLLGFLFCLFQSSLFCRSSSIDNVLSLLFCS* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 11,510.242 | ||
Theoretical pI: | 5.848 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1740 | ||
Instability index: | 46.928 | ||
aromaticity | 0.107 | ||
GRAVY | 0.482 | ||
Secondary Structure Fraction | |||
Helix | 0.398 | ||
turn | 0.252 | ||
sheet | 0.262 |