| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335115.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| ARGKDIESAYWELVVNDIQDACKLFEPIYDETDGGDGYVSLEVSPRLADDTENTIEAAKWLHKWVNRSNVYIKIPATAACIPSIKEVIAKGISVNVTLIFSLARYEAVIDAYLDGLEASG LSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLVGPDTVSTMPDQALQAFIDHGSVA RTIDANVSEAEGIYNA | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,917.358 | ||
| Theoretical pI: | 5.005 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 26.145 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.207 | ||
| sheet | 0.285 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335115.1 | internal | 256 | 1-768(+) |
Amino Acid sequence : | |||
| ARGKDIESAYWELVVNDIQDACKLFEPIYDETDGGDGYVSLEVSPRLADDTENTIEAAKWLHKWVNRSNVYIKIPATAACIPSIKEVIAKGISVNVTLIFSLARYEAVIDAYLDGLEASG LSDLSRVTSVASFFVSRVDTLVDKMLEKIGTPEALDLRGKAANAQAALAFQLYQKKFSGPRWEALVKKGAKKQRLLWASTSVKNPAYPDTLYVAPLVGPDTVSTMPDQALQAFIDHGSVA RTIDANVSEAEGIYNA | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 27,917.358 | ||
| Theoretical pI: | 5.005 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 26.145 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.071 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.207 | ||
| sheet | 0.285 | ||