| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335119.1 | complete | 181 | 114-659(+) |
Amino Acid sequence : | |||
| MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 181 | ||
| Molecular weight: | 11,568.017 | ||
| Theoretical pI: | 5.547 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 25.726 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.267 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335119.1 | complete | 105 | 437-120(-) |
Amino Acid sequence : | |||
| MQLIPCLHHTVPVIAIYHKYETLCVLEVVPPQWADLVLTSDIPNSEANVLVFNSLHVETNSGNGGDNFSELELVQDGGLTSSIKTNHQNTHLLLGKKPAKQLRES* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,568.017 | ||
| Theoretical pI: | 5.547 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 25.726 | ||
| aromaticity | 0.048 | ||
| GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.267 | ||
| sheet | 0.257 | ||