Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335119.1 | complete | 181 | 114-659(+) |
Amino Acid sequence : | |||
MGLTFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAV LLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIANKA* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 11,568.017 | ||
Theoretical pI: | 5.547 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 25.726 | ||
aromaticity | 0.048 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.267 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335119.1 | complete | 105 | 437-120(-) |
Amino Acid sequence : | |||
MQLIPCLHHTVPVIAIYHKYETLCVLEVVPPQWADLVLTSDIPNSEANVLVFNSLHVETNSGNGGDNFSELELVQDGGLTSSIKTNHQNTHLLLGKKPAKQLRES* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 11,568.017 | ||
Theoretical pI: | 5.547 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 25.726 | ||
aromaticity | 0.048 | ||
GRAVY | -0.122 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.267 | ||
sheet | 0.257 |