| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335125.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TPLDRCQKTPPNPVNSTGVAPSLSRTTVVRQKDLFPAISLSTPSPSIMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTI TSSYYRGAHGIIIVYDVTDSESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRAVPYETAKAFADEIGIPFMETSAKNATNVEQAFMAMSADIKNRMASQPASNSARPPTVQIRGQP VGQKNGCC | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 12,348.361 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.552 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.194 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335125.1 | 5prime_partial | 108 | 746-420(-) |
Amino Acid sequence : | |||
| AAAIFLAYRLSTDLHSRWPCTVRRRLTCHPVLNVSRHCHESLFHIRGIFCTSLHKGNANFISKSLCCFIRHSSVFSKVALVSNQEFVHILTCISVDFIQPLLHIIEAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,348.361 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.552 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.194 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335125.1 | internal | 248 | 3-746(+) |
Amino Acid sequence : | |||
| TPLDRCQKTPPNPVNSTGVAPSLSRTTVVRQKDLFPAISLSTPSPSIMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTI TSSYYRGAHGIIIVYDVTDSESFNNVKQWLNEIDRYASENVNKLLVGNKCDLAENRAVPYETAKAFADEIGIPFMETSAKNATNVEQAFMAMSADIKNRMASQPASNSARPPTVQIRGQP VGQKNGCC | |||
Physicochemical properties | |||
| Number of amino acids: | 248 | ||
| Molecular weight: | 12,348.361 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.552 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.194 | ||
| sheet | 0.204 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335125.1 | 5prime_partial | 108 | 746-420(-) |
Amino Acid sequence : | |||
| AAAIFLAYRLSTDLHSRWPCTVRRRLTCHPVLNVSRHCHESLFHIRGIFCTSLHKGNANFISKSLCCFIRHSSVFSKVALVSNQEFVHILTCISVDFIQPLLHIIEAF* | |||
Physicochemical properties | |||
| Number of amino acids: | 108 | ||
| Molecular weight: | 12,348.361 | ||
| Theoretical pI: | 9.235 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7365 | ||
| Instability index: | 63.552 | ||
| aromaticity | 0.102 | ||
| GRAVY | 0.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.380 | ||
| turn | 0.194 | ||
| sheet | 0.204 | ||