Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335131.1 | 3prime_partial | 249 | 67-813(+) |
Amino Acid sequence : | |||
MSAPLFAWPWEFLGNYKLAVYGIFLAKAMHSRYVAESTTQTNWFLHIFIICMLRLLMYQLWCSYSNMLFLTRNRQINKQGVDFNQIDREWNWDNFVILQAIVAALVVYMFPSLDTLSVWN KNGITAVVALHVAISEPLFYTLHRCFHGDYLFTHYHYLHHSSPVPQPLTAGHATFLEHLLLTVVVAVPIIGSFMMGLGSIHLIYGYILLFDLLRCLGHSNVEMVPHQIFDAAPFLKYLLY TPTYHSLHH | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,520.143 | ||
Theoretical pI: | 6.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32470 | ||
Instability index: | 35.343 | ||
aromaticity | 0.162 | ||
GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.270 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335131.1 | complete | 111 | 420-755(+) |
Amino Acid sequence : | |||
MEQKWHHCSSGSTRGDFGAPFLHLASMLSWRLSLHPLSLSPPFITCATAPYSWTCYVFGTSVAHCCGCCSNNRFFYDGAWIDTLDIWLHLAFRFAEMFRPFQCGDGSPSDI* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,520.143 | ||
Theoretical pI: | 6.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32470 | ||
Instability index: | 35.343 | ||
aromaticity | 0.162 | ||
GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.270 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335131.1 | 3prime_partial | 249 | 67-813(+) |
Amino Acid sequence : | |||
MSAPLFAWPWEFLGNYKLAVYGIFLAKAMHSRYVAESTTQTNWFLHIFIICMLRLLMYQLWCSYSNMLFLTRNRQINKQGVDFNQIDREWNWDNFVILQAIVAALVVYMFPSLDTLSVWN KNGITAVVALHVAISEPLFYTLHRCFHGDYLFTHYHYLHHSSPVPQPLTAGHATFLEHLLLTVVVAVPIIGSFMMGLGSIHLIYGYILLFDLLRCLGHSNVEMVPHQIFDAAPFLKYLLY TPTYHSLHH | |||
Physicochemical properties | |||
Number of amino acids: | 249 | ||
Molecular weight: | 12,520.143 | ||
Theoretical pI: | 6.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32470 | ||
Instability index: | 35.343 | ||
aromaticity | 0.162 | ||
GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.270 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335131.1 | complete | 111 | 420-755(+) |
Amino Acid sequence : | |||
MEQKWHHCSSGSTRGDFGAPFLHLASMLSWRLSLHPLSLSPPFITCATAPYSWTCYVFGTSVAHCCGCCSNNRFFYDGAWIDTLDIWLHLAFRFAEMFRPFQCGDGSPSDI* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,520.143 | ||
Theoretical pI: | 6.250 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31970 32470 | ||
Instability index: | 35.343 | ||
aromaticity | 0.162 | ||
GRAVY | 0.068 | ||
Secondary Structure Fraction | |||
Helix | 0.306 | ||
turn | 0.270 | ||
sheet | 0.207 |