Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335137.1 | 5prime_partial | 181 | 2-547(+) |
Amino Acid sequence : | |||
EKKTPHHNNFPNKTYHTHRQKSDSQKYVKNTWPHILKSKPHIKSMLNYYSSNSSKPTQWDSQGNNGKLAQSLASPSTPEKPNASGSTPPGPYGTPPQPQPSTRRPPQKKHRRPPSSQSWG NKTQHTHTPGGGTRPPGCHSASSTLPRNGTLSSPKYPLLATLLQRCSLFLMGRNQPWTPKK* | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 12,278.365 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 61.259 | ||
aromaticity | 0.076 | ||
GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.257 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335137.1 | 5prime_partial | 142 | 581-153(-) |
Amino Acid sequence : | |||
EKGIKGEEKVCAIFLESMVDFAPSKIGNNVEAVSPEADISERKVSRFEGVLRKPSDNPVVVSPHQEYEYAVFYCPKTETTVAYDVFFVGAGGSKAEAVAVSHRDPGEWNPKHLAFQVLKV KPGTVPVCHYFPENPIVWVSKN* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 12,278.365 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 61.259 | ||
aromaticity | 0.076 | ||
GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.257 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335137.1 | complete | 105 | 195-512(+) |
Amino Acid sequence : | |||
MANWHSPWLHLQHLKSQMLRVPLPRVPMGHRHSLSLRPAGPHKKNIVGHRRLSLGAIKHSILILLVGGHDHRVVTRLPQHSLETGHFPLRNIRFWRHCFNVVPYF* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,278.365 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 61.259 | ||
aromaticity | 0.076 | ||
GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.257 | ||
sheet | 0.210 |