| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335138.1 | 5prime_partial | 176 | 1-531(+) |
Amino Acid sequence : | |||
| ARGIKGFDPDKHLEKAVIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSLQVITEERGIPSYWVDTPERIGPGNR IAHKLAHGELVEKEEWIPKGPVTVGISAGASTPHKVIEDIIVKVFQIKTEQESYAL* | |||
Physicochemical properties | |||
| Number of amino acids: | 176 | ||
| Molecular weight: | 19,573.998 | ||
| Theoretical pI: | 5.185 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 32.273 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.353 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||