| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 227 | 777-94(-) |
Amino Acid sequence : | |||
| SQNHTFRQSGGAGGEGQRNGVVWIDLNLRRLRLVGFREGREMQASLRRGVDGEDGEILTEDEGVIACVPELAHVLGLRDDDLGVGGVELLEDLFGGAERVGGGGDGADHGSSHESEDEFG AVLEQHHDDVASLESEVGEAGGDFAADEVRLGKGVGFARIAGDEAWAVGELGEVLEAVCVEREVVGDGNGGEFGDKNMSFLGGLSLGESMRGELGILSFGSRHRQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 3prime_partial | 226 | 100-777(+) |
Amino Acid sequence : | |||
| MLSVAAAETQNPELSSHALPQTQTSQETHIFVSKLPSIPIPNHLPLHTYCFQNLSQFPDRPCLIAGNSGKSYSFAETHLICRKVAAGFANLGLKRGNVVMVLLQNCAEFVFTFMGASMIG AVTTTANPFCTSKEIFKQFNASNSKVIITQSQYVSKLRDTGDDSLVFGEDFSVFTIDAPPEGCLHFSTLSEADEAEAPEVEIDPDDAVALPFSSGTTGLPKGVILT | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 194 | 3-587(+) |
Amino Acid sequence : | |||
| TRSIRFRRENQDQHIHLASPAVDIKQNPSIINNVVCGGCRNSESRALLSCSPPNSNLPRNSYFCLQTPLHSHPQPPPSPHILLPEPLPIPRPPMPHRRQFWQILLLCRDAPHLPQSRRRL RQPRTQERQRRHGAAPELRRIRLHFHGSFHDRRRHHHRQPFLHLQRDLQAIQRLQLQGHHHAVPVREQAPGHRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 154 | 776-312(-) |
Amino Acid sequence : | |||
| VRITPFGNPVVPEEKGSATASSGSISTSGASASSASERVEKCKHPSGGASMVKTEKSSPKTRESSPVSRSLLTYWDCVMMTLELEALNCLKISLEVQKGLAVVVTAPIMEAPMKVKTNSA QFWSSTMTTLPLLSPRLAKPAATLRQMRCVSAKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | complete | 101 | 149-454(+) |
Amino Acid sequence : | |||
| MLSPKLKPPKKLIFLSPNSPPFPSPTTSLSTHTASRTSPNSPTAHASSPAILANPTPLPRRTSSAAKSPPASPTSDSREATSSWCCSRTAPNSSSLSWELP* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 227 | 777-94(-) |
Amino Acid sequence : | |||
| SQNHTFRQSGGAGGEGQRNGVVWIDLNLRRLRLVGFREGREMQASLRRGVDGEDGEILTEDEGVIACVPELAHVLGLRDDDLGVGGVELLEDLFGGAERVGGGGDGADHGSSHESEDEFG AVLEQHHDDVASLESEVGEAGGDFAADEVRLGKGVGFARIAGDEAWAVGELGEVLEAVCVEREVVGDGNGGEFGDKNMSFLGGLSLGESMRGELGILSFGSRHRQHC* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 3prime_partial | 226 | 100-777(+) |
Amino Acid sequence : | |||
| MLSVAAAETQNPELSSHALPQTQTSQETHIFVSKLPSIPIPNHLPLHTYCFQNLSQFPDRPCLIAGNSGKSYSFAETHLICRKVAAGFANLGLKRGNVVMVLLQNCAEFVFTFMGASMIG AVTTTANPFCTSKEIFKQFNASNSKVIITQSQYVSKLRDTGDDSLVFGEDFSVFTIDAPPEGCLHFSTLSEADEAEAPEVEIDPDDAVALPFSSGTTGLPKGVILT | |||
Physicochemical properties | |||
| Number of amino acids: | 226 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 194 | 3-587(+) |
Amino Acid sequence : | |||
| TRSIRFRRENQDQHIHLASPAVDIKQNPSIINNVVCGGCRNSESRALLSCSPPNSNLPRNSYFCLQTPLHSHPQPPPSPHILLPEPLPIPRPPMPHRRQFWQILLLCRDAPHLPQSRRRL RQPRTQERQRRHGAAPELRRIRLHFHGSFHDRRRHHHRQPFLHLQRDLQAIQRLQLQGHHHAVPVREQAPGHRR* | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | 5prime_partial | 154 | 776-312(-) |
Amino Acid sequence : | |||
| VRITPFGNPVVPEEKGSATASSGSISTSGASASSASERVEKCKHPSGGASMVKTEKSSPKTRESSPVSRSLLTYWDCVMMTLELEALNCLKISLEVQKGLAVVVTAPIMEAPMKVKTNSA QFWSSTMTTLPLLSPRLAKPAATLRQMRCVSAKE* | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335149.1 | complete | 101 | 149-454(+) |
Amino Acid sequence : | |||
| MLSPKLKPPKKLIFLSPNSPPFPSPTTSLSTHTASRTSPNSPTAHASSPAILANPTPLPRRTSSAAKSPPASPTSDSREATSSWCCSRTAPNSSSLSWELP* | |||
Physicochemical properties | |||
| Number of amino acids: | 101 | ||
| Molecular weight: | 10,550.758 | ||
| Theoretical pI: | 10.543 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11000 11125 | ||
| Instability index: | 88.885 | ||
| aromaticity | 0.040 | ||
| GRAVY | -0.577 | ||
Secondary Structure Fraction | |||
| Helix | 0.149 | ||
| turn | 0.465 | ||
| sheet | 0.218 | ||