| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335150.1 | complete | 157 | 273-746(+) |
Amino Acid sequence : | |||
| MNSLTDSSVSSDPAAGTTKATGNFTSSLIFLRYNGRIRDLRMGDEKSLQLSWWYLKAFEFDELLHPVYNENVIVFIHKPYIPCMQPTIHVYGSRRCLNIIQVPFHDLGSTDANFTGLGAG QGATCFRVDDLELGVADHIATRPRLGWYWLFCKPWGH* | |||
Physicochemical properties | |||
| Number of amino acids: | 157 | ||
| Molecular weight: | 11,203.687 | ||
| Theoretical pI: | 7.847 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.321 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.387 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335150.1 | complete | 155 | 770-303(-) |
Amino Acid sequence : | |||
| MTEAGPVLSMSPWFAKQPVPTKSGSCGNVVRNAELKVIDPETGCSLPRTQPGEICIRGPQIMKGYLNDVEATARTIDVDGWLHTGDIGFVDEDDDIFIVDRVKELIKFKGFQVPPAELEA LLISHSQISDAAVVPQKDEAAGEVTRGFCSTCSRI* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 11,203.687 | ||
| Theoretical pI: | 7.847 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.321 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.387 | ||
| sheet | 0.189 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335150.1 | 3prime_partial | 106 | 454-771(+) |
Amino Acid sequence : | |||
| MSSFTLSTMKMSSSSSTNPISPVCSQPSTSMVLAVASTSFKYPFMIWGPRMQISPGWVRGREQPVSGSMTLSSALRTTLPHDPDLVGTGCFANHGDIDSTGPASVM | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,203.687 | ||
| Theoretical pI: | 7.847 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.321 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.025 | ||
Secondary Structure Fraction | |||
| Helix | 0.226 | ||
| turn | 0.387 | ||
| sheet | 0.189 | ||