Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335158.1 | 5prime_partial | 194 | 3-587(+) |
Amino Acid sequence : | |||
LSWTLFPMPAFTTNCLAPLAKVINDRFGIVEGLMTTVHSITATQKTVDGPSSKDWRGGRAASFNIIPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAA IKEESEGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVIDLIVHIASVA* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 20,859.605 | ||
Theoretical pI: | 6.172 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 27960 | ||
Instability index: | 26.620 | ||
aromaticity | 0.082 | ||
GRAVY | 0.087 | ||
Secondary Structure Fraction | |||
Helix | 0.330 | ||
turn | 0.242 | ||
sheet | 0.232 |