| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335161.1 | 5prime_partial | 188 | 731-165(-) |
Amino Acid sequence : | |||
| FKKSLEEDVACHTNGDFCKLLLPLVSSYRYSGDDVNPHLAKSEAGILHEKIGANEFSCDDVIRILTTRSKAQINATLNQYKNQFGNDIIKDLKADPKDEFLATLRATVKCLIFPEKYFWK VLRLGINKLGTDEGVLTRVVATRAEVDMKMIKDVFEKWNTVPLDKAIAKDTHGDYEKMVLTLIGHVEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 16,063.439 | ||
| Theoretical pI: | 6.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 42.801 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.231 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335161.1 | complete | 143 | 177-608(+) |
Amino Acid sequence : | |||
| MSNEGQNHLLIISMSVLGNGFVKGDRVPFLKHILDHLHVHLRPCGHHSRQHSFVRPQLVDPQPENLPEVLLGKDQALHSGSQCCEELVFRVGFQILDYIVAKLILVLVECCIDLCFASCG QNSDHIITAEFIRTNLLVQNTSF* | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 16,063.439 | ||
| Theoretical pI: | 6.165 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
| Instability index: | 42.801 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
| Helix | 0.364 | ||
| turn | 0.224 | ||
| sheet | 0.231 | ||