Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335161.1 | 5prime_partial | 188 | 731-165(-) |
Amino Acid sequence : | |||
FKKSLEEDVACHTNGDFCKLLLPLVSSYRYSGDDVNPHLAKSEAGILHEKIGANEFSCDDVIRILTTRSKAQINATLNQYKNQFGNDIIKDLKADPKDEFLATLRATVKCLIFPEKYFWK VLRLGINKLGTDEGVLTRVVATRAEVDMKMIKDVFEKWNTVPLDKAIAKDTHGDYEKMVLTLIGHVEE* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 16,063.439 | ||
Theoretical pI: | 6.165 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
Instability index: | 42.801 | ||
aromaticity | 0.063 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.224 | ||
sheet | 0.231 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335161.1 | complete | 143 | 177-608(+) |
Amino Acid sequence : | |||
MSNEGQNHLLIISMSVLGNGFVKGDRVPFLKHILDHLHVHLRPCGHHSRQHSFVRPQLVDPQPENLPEVLLGKDQALHSGSQCCEELVFRVGFQILDYIVAKLILVLVECCIDLCFASCG QNSDHIITAEFIRTNLLVQNTSF* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 16,063.439 | ||
Theoretical pI: | 6.165 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1865 | ||
Instability index: | 42.801 | ||
aromaticity | 0.063 | ||
GRAVY | 0.156 | ||
Secondary Structure Fraction | |||
Helix | 0.364 | ||
turn | 0.224 | ||
sheet | 0.231 |