| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335177.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
| ARGILSRSSEIAEIFVEMDSDYGVQRELSDLQKLRSQYQPELPPCLQGTTVRVEFGDVTTAADPLGAHTISRTFPHTYGQPLAHFLRANAKVPDAQIITEHPAVRVGVVFCGRQSPGGHN VIWGLHDAIKVHNPKSVLLGFLGGSDGLFAQRTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALNACTSLKLDALVIIGGVTSNTDAAHLAETFAERKCPTKVVGIPVTLNGDL KNQFVETNVGFDTICKVNSQLISNVCTDAL | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 29,195.737 | ||
| Theoretical pI: | 5.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 35.022 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.230 | ||
| sheet | 0.226 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335177.1 | internal | 270 | 1-810(+) |
Amino Acid sequence : | |||
| ARGILSRSSEIAEIFVEMDSDYGVQRELSDLQKLRSQYQPELPPCLQGTTVRVEFGDVTTAADPLGAHTISRTFPHTYGQPLAHFLRANAKVPDAQIITEHPAVRVGVVFCGRQSPGGHN VIWGLHDAIKVHNPKSVLLGFLGGSDGLFAQRTLEITDDILSTYKNQGGYDLLGRTKDQIRTTEQVNAALNACTSLKLDALVIIGGVTSNTDAAHLAETFAERKCPTKVVGIPVTLNGDL KNQFVETNVGFDTICKVNSQLISNVCTDAL | |||
Physicochemical properties | |||
| Number of amino acids: | 270 | ||
| Molecular weight: | 29,195.737 | ||
| Theoretical pI: | 5.899 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13325 | ||
| Instability index: | 35.022 | ||
| aromaticity | 0.059 | ||
| GRAVY | -0.109 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.230 | ||
| sheet | 0.226 | ||