Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335178.1 | 5prime_partial | 195 | 723-136(-) |
Amino Acid sequence : | |||
NAICHFFGYQARGSLPSKFDCDYAYVLGSIGYHVIAAGLNGYMATVTNLKNPVNKWRCGAAPITAMLTVKRYGRGHGDTNLGRPALHPATVDLKGKAYELLRQNATKFLLDDVYRNPGPL QFDGPGADSKPVFLCVEDQDYMGRIKKLQEYLDKVRSIVKPGCSQDVLKAALSAMASVTDILSVILTPTSGNIPI* | |||
Physicochemical properties | |||
Number of amino acids: | 195 | ||
Molecular weight: | 15,462.697 | ||
Theoretical pI: | 10.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 47.045 | ||
aromaticity | 0.112 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.231 | ||
sheet | 0.179 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335178.1 | complete | 134 | 121-525(+) |
Amino Acid sequence : | |||
MRKFNLYGDISTGRGQDHRQNVSYRSHGAQSSFENILRASRFHNRADLVQVFLQFLYPTHVVLIFDAQKNRLGVGTWAIKLKRSWISVYVVQQKLGCILPQQLISLSLQINSRWMQSWSS KICITMTTAIAFNS* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,462.697 | ||
Theoretical pI: | 10.532 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
Instability index: | 47.045 | ||
aromaticity | 0.112 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.358 | ||
turn | 0.231 | ||
sheet | 0.179 |