| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335178.1 | 5prime_partial | 195 | 723-136(-) |
Amino Acid sequence : | |||
| NAICHFFGYQARGSLPSKFDCDYAYVLGSIGYHVIAAGLNGYMATVTNLKNPVNKWRCGAAPITAMLTVKRYGRGHGDTNLGRPALHPATVDLKGKAYELLRQNATKFLLDDVYRNPGPL QFDGPGADSKPVFLCVEDQDYMGRIKKLQEYLDKVRSIVKPGCSQDVLKAALSAMASVTDILSVILTPTSGNIPI* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 15,462.697 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 47.045 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.231 | ||
| sheet | 0.179 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335178.1 | complete | 134 | 121-525(+) |
Amino Acid sequence : | |||
| MRKFNLYGDISTGRGQDHRQNVSYRSHGAQSSFENILRASRFHNRADLVQVFLQFLYPTHVVLIFDAQKNRLGVGTWAIKLKRSWISVYVVQQKLGCILPQQLISLSLQINSRWMQSWSS KICITMTTAIAFNS* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 15,462.697 | ||
| Theoretical pI: | 10.532 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27960 28085 | ||
| Instability index: | 47.045 | ||
| aromaticity | 0.112 | ||
| GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
| Helix | 0.358 | ||
| turn | 0.231 | ||
| sheet | 0.179 | ||