Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	internal	261	3-785(+)
Amino Acid sequence :
TRFDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLA TKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAH GGGAFSGKDPTKVDRSGAYIV
Physicochemical properties
Number of amino acids:		261
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	5prime_partial	138	785-369(-)
Amino Acid sequence :
DNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPI GSQPRARTVLADLRQTSA*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	3prime_partial	119	427-783(+)
Amino Acid sequence :
MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTL
Physicochemical properties
Number of amino acids:		119
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	3prime_partial	117	353-3(-)
Amino Acid sequence :
MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIEPR
Physicochemical properties
Number of amino acids:		117
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	internal	261	3-785(+)
Amino Acid sequence :
TRFDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLA TKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAH GGGAFSGKDPTKVDRSGAYIV
Physicochemical properties
Number of amino acids:		261
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	5prime_partial	138	785-369(-)
Amino Acid sequence :
DNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPI GSQPRARTVLADLRQTSA*
Physicochemical properties
Number of amino acids:		138
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	3prime_partial	119	427-783(+)
Amino Acid sequence :
MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTL
Physicochemical properties
Number of amino acids:		119
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335179.1	3prime_partial	117	353-3(-)
Amino Acid sequence :
MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIEPR
Physicochemical properties
Number of amino acids:		117
Molecular weight:		12,400.334
Theoretical pI:		8.012
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		27.303
aromaticity		0.026
GRAVY		0.361
Secondary Structure Fraction
Helix		0.359
turn		0.231
sheet		0.282