| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TRFDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLA TKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAH GGGAFSGKDPTKVDRSGAYIV | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 5prime_partial | 138 | 785-369(-) |
Amino Acid sequence : | |||
| DNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPI GSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 3prime_partial | 119 | 427-783(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTL | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 3prime_partial | 117 | 353-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIEPR | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | internal | 261 | 3-785(+) |
Amino Acid sequence : | |||
| TRFDACLEQDPDSKVACETCTKTNMVMVFGEITTKANIDYEKIVRDTCRSIGFVSDDVGLDADKCKVLVNIEQQSPDIAQGVHGHLTKRPEDIGAGDQGHMFGYATDETPEYMPLSHVLA TKLGARLTEVRKDGTCPWLRPDGKTQVTVEYYNENGAMVPIRVHTVLISTQHDETVTNDEIARDLKEHVIKPVIPEKYLDEKTIFHLNPSGRFVIGGPHGDAGLTGRKIIIDTYGGWGAH GGGAFSGKDPTKVDRSGAYIV | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 5prime_partial | 138 | 785-369(-) |
Amino Acid sequence : | |||
| DNVGSTPVDLGRVLPGEGPAAVGPPPAVGVDDDLTAGETRVAMGPTDDETPGGIKVEDGFLVQILLGDDRLDDMLLEIPGDLVVGDGLVVLSRDEDGVDPDGDHRTVLVVVLDRDLGLPI GSQPRARTVLADLRQTSA* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 3prime_partial | 119 | 427-783(+) |
Amino Acid sequence : | |||
| MGRPRSRSSTTTRTVRWSPSGSTPSSSRLSTTRPSPTTRSPGISRSMSSSRSSPRSIWTRKPSSTLIPPGVSSSVGPMATRVSPAVRSSSTPTAGGGPTAAGPSPGRTLPRSTGVEPTL | |||
Physicochemical properties | |||
| Number of amino acids: | 119 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335179.1 | 3prime_partial | 117 | 353-3(-) |
Amino Acid sequence : | |||
| MTKRHVLGGFVGGVPKHVALVTGPDILRAFGQMAVNALSDIRALLLDVDKNLTLVSIETNIVGNKPNRAAGVAHDLLVVYVGLGCDLSKDHHHVGLGASLTSHLTIRILLEASIEPR | |||
Physicochemical properties | |||
| Number of amino acids: | 117 | ||
| Molecular weight: | 12,400.334 | ||
| Theoretical pI: | 8.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 27.303 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.361 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.231 | ||
| sheet | 0.282 | ||