Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335181.1	5prime_partial	240	2-724(+)
Amino Acid sequence :
PPLSNPSAMSSTALSLTFFSLKSSADSPISKIGICAQSPFSVSVKRSFSVSKSDVISTPIRKIRPSFVVCSASTSDNGSSEETPIELKYPAFPTVMDINQIRDILPHRFPFLLVDRVIEY TPGVSAVAIKNVTINDNFFPGHFPERPIMPGVLMVEAMAQVGGLVMLQPEVGGSRENFFFAGVDKVRFRKPVIAGDTLVMRMNLVKLQKRFGIAKMEGKAYVGGEVVCEGEFLMAVGNSN *
Physicochemical properties
Number of amino acids:		240
Molecular weight:		16,235.279
Theoretical pI:		10.801
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21220
Instability index:		69.588
aromaticity		0.072
GRAVY		-0.867
Secondary Structure Fraction
Helix		0.252
turn		0.237
sheet		0.187

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335181.1	complete	139	427-8(-)
Amino Acid sequence :
MPGKEIIIYCHILDSHSRHPRSVLNHSIHKQKWKSVRQNITNLINIHHRRKCRILQFNRCFFRGAVVAGGSGADDKTWADLPYRRGNHIGFGDAERSLDGNRERRLSANAYLRNWRVRRA LEGEESQGERCGRHCRRIA*
Physicochemical properties
Number of amino acids:		139
Molecular weight:		16,235.279
Theoretical pI:		10.801
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20970 21220
Instability index:		69.588
aromaticity		0.072
GRAVY		-0.867
Secondary Structure Fraction
Helix		0.252
turn		0.237
sheet		0.187