Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335196.1 | 5prime_partial | 151 | 3-458(+) |
Amino Acid sequence : | |||
TTSRAEFGTRVRAAAHDVRFLLYIYHKMVEKLNERSLWYLAVRGALYCRCFCINDNNFVDWPALPPIPETLIADNQAPEEETLSVLDVPPGKMGCIIGKRGVNILAIKQGCSAEIFFGGD KGPPDKVFIIGPVKQVRKAEAMLRGRMLNIY* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 10,933.844 | ||
Theoretical pI: | 11.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 44.274 | ||
aromaticity | 0.068 | ||
GRAVY | 0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.350 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335196.1 | complete | 103 | 451-140(-) |
Amino Acid sequence : | |||
MFNILPLSIASAFLTCFTGPIMNTLSGGPLSPPKKISALHPCFIAKILTPRFPIMHPIFPGGTSRTERVSSSGAWLSAIRVSGIGGSAGQSTKLLSLMQKHRQ* | |||
Physicochemical properties | |||
Number of amino acids: | 103 | ||
Molecular weight: | 10,933.844 | ||
Theoretical pI: | 11.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 44.274 | ||
aromaticity | 0.068 | ||
GRAVY | 0.268 | ||
Secondary Structure Fraction | |||
Helix | 0.291 | ||
turn | 0.350 | ||
sheet | 0.223 |