Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335197.1 | 5prime_partial | 151 | 1-456(+) |
Amino Acid sequence : | |||
ARCLALVSGAYMMLATTSLVGILGDPITKQDFDWITNEPPILRAASVICRLMDDVVGHGIEQKISSVDCYMKENGCSKMEAVGEFSKRVKKAWKNLNEEWVEPRAASMVILVRVVNLARV INLLYVGEDSYGNSSVKTKELIKGVLVDPIK* | |||
Physicochemical properties | |||
Number of amino acids: | 151 | ||
Molecular weight: | 16,673.369 | ||
Theoretical pI: | 7.847 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22710 | ||
Instability index: | 29.275 | ||
aromaticity | 0.060 | ||
GRAVY | 0.112 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.219 | ||
sheet | 0.272 |