| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335206.1 | 5prime_partial | 257 | 792-19(-) |
Amino Acid sequence : | |||
| ARGQTPLSRLLLQQGDESMAAYFLLQNSPVMVYRWVKLSSRTLTNQSPDSSDEFWEYASKNPAFSKVFNEAMACHARQAVSQILGGCREVFEGIGCLVDVGGGDGTAIRSIVKGCPWIRG INFDLPHVASAAPPLHGIEHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLALDMVMLAHTDTGKERTIEEWKYVLNGAGFSS YTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 18,224.617 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 64.107 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.235 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335206.1 | 3prime_partial | 162 | 307-792(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPTYMLDAVEGRRCRRNMREIEINPANPGATLHDGAYSCPVAASNIHQTTNPLKNLPTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGTLIGE GARAQLHPPIHHHRAVLQQKIRRHAFVSLLEEQTRKRSLASC | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,224.617 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 64.107 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.235 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335206.1 | 5prime_partial | 257 | 792-19(-) |
Amino Acid sequence : | |||
| ARGQTPLSRLLLQQGDESMAAYFLLQNSPVMVYRWVKLSSRTLTNQSPDSSDEFWEYASKNPAFSKVFNEAMACHARQAVSQILGGCREVFEGIGCLVDVGGGDGTAIRSIVKGCPWIRG INFDLPHVASAAPPLHGIEHVGGDMFKEVPKADAVFIMWVLHDWGDEECIEILKKCKEAVPKETGKVIIAEAVIGEGEGDKYINGIRLALDMVMLAHTDTGKERTIEEWKYVLNGAGFSS YTVKDIDSIISIIEAHP* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 18,224.617 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 64.107 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.235 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335206.1 | 3prime_partial | 162 | 307-792(+) |
Amino Acid sequence : | |||
| MQHPHDENSVSLGNLFEHVPTYMLDAVEGRRCRRNMREIEINPANPGATLHDGAYSCPVAASNIHQTTNPLKNLPTTTQDLRHGLPSVARHGLVEHFAERWILRRVFPKLIGGVGTLIGE GARAQLHPPIHHHRAVLQQKIRRHAFVSLLEEQTRKRSLASC | |||
Physicochemical properties | |||
| Number of amino acids: | 162 | ||
| Molecular weight: | 18,224.617 | ||
| Theoretical pI: | 9.798 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 64.107 | ||
| aromaticity | 0.043 | ||
| GRAVY | -0.485 | ||
Secondary Structure Fraction | |||
| Helix | 0.259 | ||
| turn | 0.235 | ||
| sheet | 0.265 | ||