| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335214.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| ARGQQHQYQVSCSDFTLFVDKENKWKEILSSDVAGLLSLYEAAHVRIHGEHILDEAVAFTNHHLSRSLPQLESPLKEKVQHALEYPLHKSLTVLHMRSHILSYEEDSSSNKLLLRLAKLN FNYLQNVYRDELHQLLKWFNKFDLQSKLPYARHRMVECYIWGMAHHFKPQYSYVRMVVAKTYQMLSIMDDTYDNYVTIEELELFNRALERWDIDEINHLPVYLKHFYKFIMRVTEEFDRD AEKAEKSYAIPYYIQGMETAR | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 31,209.235 | ||
| Theoretical pI: | 6.357 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48820 48945 | ||
| Instability index: | 46.290 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.153 | ||
| sheet | 0.299 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335214.1 | internal | 261 | 1-783(+) |
Amino Acid sequence : | |||
| ARGQQHQYQVSCSDFTLFVDKENKWKEILSSDVAGLLSLYEAAHVRIHGEHILDEAVAFTNHHLSRSLPQLESPLKEKVQHALEYPLHKSLTVLHMRSHILSYEEDSSSNKLLLRLAKLN FNYLQNVYRDELHQLLKWFNKFDLQSKLPYARHRMVECYIWGMAHHFKPQYSYVRMVVAKTYQMLSIMDDTYDNYVTIEELELFNRALERWDIDEINHLPVYLKHFYKFIMRVTEEFDRD AEKAEKSYAIPYYIQGMETAR | |||
Physicochemical properties | |||
| Number of amino acids: | 261 | ||
| Molecular weight: | 31,209.235 | ||
| Theoretical pI: | 6.357 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 48820 48945 | ||
| Instability index: | 46.290 | ||
| aromaticity | 0.126 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.352 | ||
| turn | 0.153 | ||
| sheet | 0.299 | ||