| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335220.1 | complete | 151 | 79-534(+) |
Amino Acid sequence : | |||
| MDAAELKRIFQMFDKNGDGRITKNELNDSLENMGIFIPGSELSQLINKVDVNGDGCVDIDEFGTLYQTIMDERDEEEDMKEAFNVFDRNGDGFITVDELKSVLASLGLKQGKGADDCKKM IMRVDEDGDGRVDFSEFKQMMRGGGLVALSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,819.697 | ||
| Theoretical pI: | 4.298 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
| Instability index: | 16.425 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.497 | ||
Secondary Structure Fraction | |||
| Helix | 0.265 | ||
| turn | 0.225 | ||
| sheet | 0.265 | ||