Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335224.1 | 5prime_partial | 212 | 807-169(-) |
Amino Acid sequence : | |||
EDSKTRAIIESPALGPGSFAALCPWESRAELKDRLLKYARTAHLFSMIRDSGSGEVICEGRVGYKFDDSDKENMKVGLRRAVRILIAAGAAEVGTHQSDGQRVSCRGVSEEAVEEFVETV VAAEGPKAMVEKWTTYCSAHQMGSCRMGVSEREGAVDDNGESWEAEGLFVCDASVLPTAVGVNPMITIQSTAYCLSKKIAQRLKTEEKEKND* | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 21,698.921 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.753 | ||
aromaticity | 0.048 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.262 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335224.1 | complete | 187 | 115-678(+) |
Amino Acid sequence : | |||
MTQSLHTIETNFSIHPNPSIILLFFFRLQPLSNLLGQTIRSRLNRDHRIHSDSRGKHTRITHKQPLRLPTLPIVINCSFSLTHPHSAAPHLMSRAVSSPLLHHRLRPLRRHHRLHKLLHR LLTNPSATHPLPIALMRANLRSPRRNQNPHRPPQPHLHVFLIRIIEFVAHSPFTDDFSAATVSNHRE* | |||
Physicochemical properties | |||
Number of amino acids: | 187 | ||
Molecular weight: | 21,698.921 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 61.753 | ||
aromaticity | 0.048 | ||
GRAVY | -0.432 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.262 | ||
sheet | 0.225 |