| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335229.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
| GRLREYADRKVVVECPEEGVVFVEAHADATLQQFGDVLHPPFPHVEELIHDTSGFDMIFNSPILYVQVTRLKCGGFILGYRSNHLMWDGTGVCQFMTGVGELSRGTAAPSILPVWERHLL TARQPPRVSFTHHEYYVFTEDSPIPLRKMVQRSFFFPADDISALRRSLTPPLQSCSNFEVLAACV* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,878.664 | ||
| Theoretical pI: | 5.879 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 61.881 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.222 | ||
| sheet | 0.238 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335229.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
| GRLREYADRKVVVECPEEGVVFVEAHADATLQQFGDVLHPPFPHVEELIHDTSGFDMIFNSPILYVQVTRLKCGGFILGYRSNHLMWDGTGVCQFMTGVGELSRGTAAPSILPVWERHLL TARQPPRVSFTHHEYYVFTEDSPIPLRKMVQRSFFFPADDISALRRSLTPPLQSCSNFEVLAACV* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,878.664 | ||
| Theoretical pI: | 5.879 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 61.881 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.222 | ||
| sheet | 0.238 | ||