Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335229.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
GRLREYADRKVVVECPEEGVVFVEAHADATLQQFGDVLHPPFPHVEELIHDTSGFDMIFNSPILYVQVTRLKCGGFILGYRSNHLMWDGTGVCQFMTGVGELSRGTAAPSILPVWERHLL TARQPPRVSFTHHEYYVFTEDSPIPLRKMVQRSFFFPADDISALRRSLTPPLQSCSNFEVLAACV* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,878.664 | ||
Theoretical pI: | 5.879 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 61.881 | ||
aromaticity | 0.108 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.222 | ||
sheet | 0.238 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335229.1 | 5prime_partial | 185 | 3-560(+) |
Amino Acid sequence : | |||
GRLREYADRKVVVECPEEGVVFVEAHADATLQQFGDVLHPPFPHVEELIHDTSGFDMIFNSPILYVQVTRLKCGGFILGYRSNHLMWDGTGVCQFMTGVGELSRGTAAPSILPVWERHLL TARQPPRVSFTHHEYYVFTEDSPIPLRKMVQRSFFFPADDISALRRSLTPPLQSCSNFEVLAACV* | |||
Physicochemical properties | |||
Number of amino acids: | 185 | ||
Molecular weight: | 20,878.664 | ||
Theoretical pI: | 5.879 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
Instability index: | 61.881 | ||
aromaticity | 0.108 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.222 | ||
sheet | 0.238 |