| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335248.1 | 3prime_partial | 161 | 340-822(+) |
Amino Acid sequence : | |||
| MLRMHVKSETSQIRPYVVCAVLRGITFDEARYNSFIDLQDRLHQNICRRRTLVAIGTHDLDTIEGPFTYEALPPKDINFVPLKQTKSFSADELMEYYKKDLKLKKFLHIIEGSPVYPVIY DRKRTVLSLPPIINGAHSAITLQTKNVFIECTATDLTKANI | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,497.289 | ||
| Theoretical pI: | 8.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 62.702 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.174 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335248.1 | 3prime_partial | 161 | 340-822(+) |
Amino Acid sequence : | |||
| MLRMHVKSETSQIRPYVVCAVLRGITFDEARYNSFIDLQDRLHQNICRRRTLVAIGTHDLDTIEGPFTYEALPPKDINFVPLKQTKSFSADELMEYYKKDLKLKKFLHIIEGSPVYPVIY DRKRTVLSLPPIINGAHSAITLQTKNVFIECTATDLTKANI | |||
Physicochemical properties | |||
| Number of amino acids: | 161 | ||
| Molecular weight: | 18,497.289 | ||
| Theoretical pI: | 8.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
| Instability index: | 62.702 | ||
| aromaticity | 0.087 | ||
| GRAVY | -0.193 | ||
Secondary Structure Fraction | |||
| Helix | 0.342 | ||
| turn | 0.174 | ||
| sheet | 0.224 | ||