| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335259.1 | 5prime_partial | 204 | 2-616(+) |
Amino Acid sequence : | |||
| HHVSCRIRHEAASGLLNFMDGLLNSQDERIMIFTMNSKDGIDSALLRPGRIDMHIYFPLCDFNSFKNLASNYLGVKEHKLFPQVEEIFQSGATMSPAEISELMLVNRSSPSRALKSVISA LQTHGKSGGKLATRLSDSATASPAPPSVSEEAGGAAWKETMPKEFRKLYGLLRLKSCRRPGSFDHDESEIINGDGLSTQHTKHY* | |||
Physicochemical properties | |||
| Number of amino acids: | 204 | ||
| Molecular weight: | 22,533.338 | ||
| Theoretical pI: | 7.933 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 63.067 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.401 | ||
Secondary Structure Fraction | |||
| Helix | 0.255 | ||
| turn | 0.284 | ||
| sheet | 0.275 | ||