| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335265.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
| ARGFLPNTVMPKSVKDLLTDDKSGVNVGVNISGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTI* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,304.356 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 49.156 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335265.1 | 5prime_partial | 106 | 720-400(-) |
Amino Acid sequence : | |||
| ERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFLDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,304.356 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 49.156 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335265.1 | 5prime_partial | 149 | 1-450(+) |
Amino Acid sequence : | |||
| ARGFLPNTVMPKSVKDLLTDDKSGVNVGVNISGHGHDKDKDHDHDKDHGESHKNHKPVNVHVAPFNYHYAATETQLHDSPNVALFFLEKDLYAGNKMTLQFSKDTNQQKFLPRQVADSIP FSSDKLPEIYTKFSVEPDSDEAEAMKKTI* | |||
Physicochemical properties | |||
| Number of amino acids: | 149 | ||
| Molecular weight: | 12,304.356 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 49.156 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.264 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335265.1 | 5prime_partial | 106 | 720-400(-) |
Amino Acid sequence : | |||
| ERNIVGHRRLSLVAVKHSILILLLVAHDHRLVTRLPRHSLDTVHFPLRTMRFCRHCFDVVPYFRRGEIDHGLQRSSTDLLLPFYALFLAFLDGFLHGLGLVGIRLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,304.356 | ||
| Theoretical pI: | 10.234 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
| Instability index: | 49.156 | ||
| aromaticity | 0.094 | ||
| GRAVY | 0.267 | ||
Secondary Structure Fraction | |||
| Helix | 0.425 | ||
| turn | 0.160 | ||
| sheet | 0.264 | ||