Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
ARGRLQLFKDYFVDETKKLVSTKPADKDGLKCAIDHMIEAQQKGEINEDNVLYIGENINVAAIETTLWSIQWGIAELVNHPEIQNKLQDELDTVLGPGVQITEPDTHKLPYLQAVIKETL RLRMAIPLLVPHMNLHDAKLGGYDIPAESKILENAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKG GQFSLHILKHSTIVLKPR | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | 5prime_partial | 130 | 775-383(-) |
Amino Acid sequence : | |||
SGLQNNGGMLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRILQDLALGRDVVATEL CIMEVHVGDQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | complete | 112 | 408-746(+) |
Amino Acid sequence : | |||
MMQSSVATTSLPRARSWRMRGGLPTTRPNGKSPRSSGPRDSWRRRLKSRPMAMTLGTSPSASAEGAALVLSLHCLFWVLRWADSYRTSSCCLHQGSRRSIRRRKVASSVFTF* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | internal | 258 | 2-775(+) |
Amino Acid sequence : | |||
ARGRLQLFKDYFVDETKKLVSTKPADKDGLKCAIDHMIEAQQKGEINEDNVLYIGENINVAAIETTLWSIQWGIAELVNHPEIQNKLQDELDTVLGPGVQITEPDTHKLPYLQAVIKETL RLRMAIPLLVPHMNLHDAKLGGYDIPAESKILENAWWLANNPAQWKKPEEFRPERFLEEEAKVEANGNDFRYLPFGVGRRSCPGIILALPILGITLGRLVQNFELLPPPGQSKIDTTEKG GQFSLHILKHSTIVLKPR | |||
Physicochemical properties | |||
Number of amino acids: | 258 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | 5prime_partial | 130 | 775-383(-) |
Amino Acid sequence : | |||
SGLQNNGGMLQNVKTELATFLRRIDLRLPWWRQQLEVLYESAQRNTQNRQCKDNTRAAPSADAEGEVPKVIAIGLDFSLLLQESLGPELLGLFPLGRVVGKPPRILQDLALGRDVVATEL CIMEVHVGDQ* | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335267.1 | complete | 112 | 408-746(+) |
Amino Acid sequence : | |||
MMQSSVATTSLPRARSWRMRGGLPTTRPNGKSPRSSGPRDSWRRRLKSRPMAMTLGTSPSASAEGAALVLSLHCLFWVLRWADSYRTSSCCLHQGSRRSIRRRKVASSVFTF* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,542.379 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23490 23615 | ||
Instability index: | 83.054 | ||
aromaticity | 0.071 | ||
GRAVY | -0.496 | ||
Secondary Structure Fraction | |||
Helix | 0.214 | ||
turn | 0.313 | ||
sheet | 0.223 |