Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335268.1	complete	119	416-57(-)
Amino Acid sequence :
MSGGLPTTRPNGKSPRSSGPRDSWRRRLKSRPMAMTLGTSPSALAEGAALVLSLHCLFWVLRWAVSYRTSRCCFPQGSRRSIRRRTGGQVQSSHFEAFHHCFEAKISLKSCFFFGLNIS*
Physicochemical properties
Number of amino acids:		119
Molecular weight:		11,636.434
Theoretical pI:		11.075
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		41.915
aromaticity		0.074
GRAVY		-0.015
Secondary Structure Fraction
Helix		0.296
turn		0.361
sheet		0.213

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY335268.1	complete	108	125-451(+)
Amino Acid sequence :
MLQNVKTEPGHLFSVVSIFDCPGGSSTSKFCTRRPNVIPKIGNARIIPGQLLRPTPKGRYLKSLPLASTLASSSKNLSGLNSSGFFHWAGLLASHHSFTKILLSARMS*
Physicochemical properties
Number of amino acids:		108
Molecular weight:		11,636.434
Theoretical pI:		11.075
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 7115
Instability index:		41.915
aromaticity		0.074
GRAVY		-0.015
Secondary Structure Fraction
Helix		0.296
turn		0.361
sheet		0.213