Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335277.1 | 5prime_partial | 120 | 3-365(+) |
Amino Acid sequence : | |||
TRYSGVTVPGGVRYANLLYAMLDAMYSALEKSGGSSVKIVLSESGWPSAGGDSATTENARIYNNNLIERVKSGTPKRPGQSTPAFIFDMFDENEKSGADYEQHFGLFFPNEQHKYPITFS * | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,351.833 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 81.789 | ||
aromaticity | 0.044 | ||
GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.195 | ||
sheet | 0.212 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335277.1 | 3prime_partial | 113 | 341-3(-) |
Amino Acid sequence : | |||
MLLIWKKQSKMLLIVRPTLLILIKHIKNEGRRALPRPFRRPTLHPLNQIIVVYPRILRRGRVPSSRRPPALRQHDLHRRAAALFQRRIHGVQHRIQQISVPYSARHGDPAVTR | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,351.833 | ||
Theoretical pI: | 12.000 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8480 | ||
Instability index: | 81.789 | ||
aromaticity | 0.044 | ||
GRAVY | -0.430 | ||
Secondary Structure Fraction | |||
Helix | 0.327 | ||
turn | 0.195 | ||
sheet | 0.212 |