| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335279.1 | 5prime_partial | 172 | 1-519(+) |
Amino Acid sequence : | |||
| APRSRAEFGTRRTLVDVGGGNGTMAKAIVEAMPTMKCTVLDLPHVVAGLESTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKDAVGIGGKVIIIDVVVGVNHDVDEVL EDQLHFDMAMMCYFNAKERTMNEWEKLISDAGFTSYKLTPAFGVRSLIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,925.652 | ||
| Theoretical pI: | 4.952 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 34.016 | ||
| aromaticity | 0.076 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.192 | ||
| sheet | 0.273 | ||