Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335291.1 | complete | 149 | 28-477(+) |
Amino Acid sequence : | |||
MVETQDSSVLAQLGWPDMRLPILYTLSWPDRIYCSEVTWPRLDLCKVDLTFKSPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEQIGYLDIFKVVELTCDKHRAELVASPS LDEIVHYDLWARDYAASLHRSPGPTPALV* | |||
Physicochemical properties | |||
Number of amino acids: | 149 | ||
Molecular weight: | 12,131.652 | ||
Theoretical pI: | 5.781 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 32.265 | ||
aromaticity | 0.173 | ||
GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.240 | ||
sheet | 0.192 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335291.1 | 5prime_partial | 104 | 748-434(-) |
Amino Acid sequence : | |||
KIQILYLYMNSCVEREFSTGNSGYVSTSEGCFFFTLFGGTVSLESKPDLIYYYNIKTCDFSWLDLLLHDFILFTMKNGKYSEKKRKNYGVVIQEQEWDRASGVN* | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 12,131.652 | ||
Theoretical pI: | 5.781 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 32.265 | ||
aromaticity | 0.173 | ||
GRAVY | -0.239 | ||
Secondary Structure Fraction | |||
Helix | 0.385 | ||
turn | 0.240 | ||
sheet | 0.192 |