| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335297.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TRFKHVEKSWQPTDFLPDSASEDFHEQVKELRERCKEIPDDYFVVLVGDMITEEALPTYQTMINTLDGVRDETGASPTPWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYL IGSGMDPRTENNPYLGFIYTSFQERATFISHGNTARHAKEHGDMKLAQICGTIAADEKRHETAYTKIVEKLFEMDPDGTVLSLADMMRKKITMPAHLMHDGVNDNLFNNFSAVAQRLGVY TAKDYADILQFLVARW | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,431.940 | ||
| Theoretical pI: | 5.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 25.257 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.172 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335297.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
| TRFKHVEKSWQPTDFLPDSASEDFHEQVKELRERCKEIPDDYFVVLVGDMITEEALPTYQTMINTLDGVRDETGASPTPWAIWTRAWTAEENRHGDLLNKYLYLSGRVDMKQIEKTIQYL IGSGMDPRTENNPYLGFIYTSFQERATFISHGNTARHAKEHGDMKLAQICGTIAADEKRHETAYTKIVEKLFEMDPDGTVLSLADMMRKKITMPAHLMHDGVNDNLFNNFSAVAQRLGVY TAKDYADILQFLVARW | |||
Physicochemical properties | |||
| Number of amino acids: | 256 | ||
| Molecular weight: | 29,431.940 | ||
| Theoretical pI: | 5.387 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42525 | ||
| Instability index: | 25.257 | ||
| aromaticity | 0.102 | ||
| GRAVY | -0.511 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.172 | ||
| sheet | 0.270 | ||