| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335309.1 | 5prime_partial | 172 | 740-222(-) |
Amino Acid sequence : | |||
| QNIKIRKTKLKGTVHQNLNLISPASLGRSTIPRGVAAFATITTTSAAATTVTTAAAAATVTASITTISSTVATVSSTVPSITILTATVTTTVAASITARATESTAASTTRLSLVDGDVTS VQILTIHRVDSISHRLLIPERNESESPGPSGLTIVDNRSRSKLVTETVTVAQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 11,444.300 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 11.485 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.100 | ||
| sheet | 0.373 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335309.1 | complete | 114 | 339-683(+) |
Amino Acid sequence : | |||
| MRDAIDAMNGQDLDGRNITVNEAQSRGGGGGGFRGPRRDGGGNGGGYGRRENSYGGNGGGYGGDSGGYGGYGGGYGSSRSGGGYGGSRSGGGGYGGERGYSSRNGGSAEGSWRN* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 11,444.300 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 11.485 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.100 | ||
| sheet | 0.373 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335309.1 | 5prime_partial | 114 | 741-397(-) |
Amino Acid sequence : | |||
| AKYQNKENQTERDRPSKSKPNFSSFPRQIHHSSRSSRVRHHNHHLRCGYHRNHRRCGCYRNRLHNHHILHCRHRILHRSLHNYSHGDRNHHRCRLHHGEGHGIHRRLHHETEPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 114 | ||
| Molecular weight: | 11,444.300 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 11.485 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.100 | ||
| sheet | 0.373 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335309.1 | complete | 110 | 364-696(+) |
Amino Acid sequence : | |||
| MVRIWTDVTSPSTRLSLVVEAAVDSVALAVMEAATVVVTVAVRIVMEGTVEDTVATVEDMVVMEAVTVAAAAAVVTVVAAAEVVVMVANAATPRGMVDLPREAGEIRFRF* | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 11,444.300 | ||
| Theoretical pI: | 4.327 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 11.485 | ||
| aromaticity | 0.027 | ||
| GRAVY | 0.958 | ||
Secondary Structure Fraction | |||
| Helix | 0.355 | ||
| turn | 0.100 | ||
| sheet | 0.373 | ||