| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335314.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
| NFISFHFKQKLKYPKHLKDPPKGRKENPTIGLIHVEQQKQMENAVKRIICKTARLLDLLLGPQLVTVATFLLPTVDGTGMQTCITFAANHLVLVVLPSQSHQRRLDDSSTKPQNQMQRRL FLNIVIGESPAIFQLLSGENQTLLIRRNSFFVLDFGLDIVDGVARLDLERYRFPSEGFHENLHFLPIL | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 15,383.944 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 35.154 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.758 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.180 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335314.1 | 5prime_partial | 133 | 566-165(-) |
Amino Acid sequence : | |||
| QNWKKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGIIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKC GHSNQLRPKKKIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,383.944 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 35.154 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.758 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.180 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335314.1 | internal | 188 | 3-566(+) |
Amino Acid sequence : | |||
| NFISFHFKQKLKYPKHLKDPPKGRKENPTIGLIHVEQQKQMENAVKRIICKTARLLDLLLGPQLVTVATFLLPTVDGTGMQTCITFAANHLVLVVLPSQSHQRRLDDSSTKPQNQMQRRL FLNIVIGESPAIFQLLSGENQTLLIRRNSFFVLDFGLDIVDGVARLDLERYRFPSEGFHENLHFLPIL | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 15,383.944 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 35.154 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.758 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.180 | ||
| sheet | 0.211 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335314.1 | 5prime_partial | 133 | 566-165(-) |
Amino Acid sequence : | |||
| QNWKKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGIIEPSLMALARKYNQDKMICRKCYARLHPRAVNCRKKKC GHSNQLRPKKKIK* | |||
Physicochemical properties | |||
| Number of amino acids: | 133 | ||
| Molecular weight: | 15,383.944 | ||
| Theoretical pI: | 10.020 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10220 | ||
| Instability index: | 35.154 | ||
| aromaticity | 0.045 | ||
| GRAVY | -0.758 | ||
Secondary Structure Fraction | |||
| Helix | 0.263 | ||
| turn | 0.180 | ||
| sheet | 0.211 | ||