Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335332.1 | complete | 122 | 346-714(+) |
Amino Acid sequence : | |||
MRMMGKWRICLLTSIPDLKGRPVKLQGVRNSEMQWLTTIMNLKVLFQMDTSKGSLRSNEVECIFLSGSGMSPRTSQPSRSTVGPSFSLQPHEFSPVNSQIEDYCHFFCCFENRGVSTDQS SS* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 11,238.044 | ||
Theoretical pI: | 4.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.136 | ||
aromaticity | 0.040 | ||
GRAVY | -1.361 | ||
Secondary Structure Fraction | |||
Helix | 0.140 | ||
turn | 0.340 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335332.1 | complete | 100 | 216-518(+) |
Amino Acid sequence : | |||
MDEAGSQRVSTDEAKREPHMSSARGNETPLNHRVSADLTPNNNNENDGKMENMFIDLNSRPQRTPGQAPRSQELGDAMVNNNHEFEGVVPDGYFKREPEK* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 11,238.044 | ||
Theoretical pI: | 4.979 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 44.136 | ||
aromaticity | 0.040 | ||
GRAVY | -1.361 | ||
Secondary Structure Fraction | |||
Helix | 0.140 | ||
turn | 0.340 | ||
sheet | 0.260 |