| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335337.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| TRFKLCGSCSKMEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVF LSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEK NPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIA | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 29,632.344 | ||
| Theoretical pI: | 8.186 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 39.315 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.243 | ||
| sheet | 0.298 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335337.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
| TRFKLCGSCSKMEKSMSPFVKKHFVLVHTAFHGAWCWYKIVALMRSSGHNVTALDLGASGINPKQALQIPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVF LSGLMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYGSVKRVFIVATENDALKKEFLKLMIEK NPPDEVKEIEGSDHVTMMSKPQQLFTTLLSIA | |||
Physicochemical properties | |||
| Number of amino acids: | 272 | ||
| Molecular weight: | 29,632.344 | ||
| Theoretical pI: | 8.186 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
| Instability index: | 39.315 | ||
| aromaticity | 0.077 | ||
| GRAVY | 0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.324 | ||
| turn | 0.243 | ||
| sheet | 0.298 | ||