Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335339.1 | complete | 213 | 31-672(+) |
Amino Acid sequence : | |||
MAKPTPFLILSLFLFITTSHALVQDFCVADLSLPAGPAGYSCKDAANVTVADFTFSGLRMGGNTTNIIGAAVTPAFDAQYPGLNGLGLSIARLDLAPGGVVPFHTHPAASELLLVVQGTI VTGFVSSFANKVYLKKLVKGDLMVFPQGLLHFQINGGGKTAVAFASFSSPNPGLQITDFALFANDLPSALVEKTTFLDDAQVKKLKGVLGGTG* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 13,972.170 | ||
Theoretical pI: | 5.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.695 | ||
aromaticity | 0.016 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.233 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335339.1 | 5prime_partial | 197 | 740-147(-) |
Amino Acid sequence : | |||
QNALKTFTNHKQEKERVRNEEINHPVPPSTPLSFFTCASSKNVVFSTNADGKSFANSAKSVICKPGLGLLKLAKATAVFPPPLIWKCSSPCGNTIRSPFTSFFRYTLFANDDTNPVTMVP CTTRRSSDAAGWVWNGTTPPGAKSSRAIDSPSPLSPGYWASKAGVTAAPMMLVVLPPMRRPEKVKSATVTLAASLQE* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 13,972.170 | ||
Theoretical pI: | 5.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.695 | ||
aromaticity | 0.016 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.233 | ||
sheet | 0.256 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335339.1 | complete | 129 | 483-94(-) |
Amino Acid sequence : | |||
MQQPLREHHQVPLHQLLQVHLVRERRHESRDDGPLHHQEELRRRRVGVERHHTAGGQVQPRDRQPQPVKPWVLGVEGRGDGGADDVGGVAAHAEAGEGEVGDGDVGSVFAGVAGGARGEG EVCHAEVLD* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 13,972.170 | ||
Theoretical pI: | 5.842 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
Instability index: | 47.695 | ||
aromaticity | 0.016 | ||
GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.233 | ||
sheet | 0.256 |