| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335339.1 | complete | 213 | 31-672(+) |
Amino Acid sequence : | |||
| MAKPTPFLILSLFLFITTSHALVQDFCVADLSLPAGPAGYSCKDAANVTVADFTFSGLRMGGNTTNIIGAAVTPAFDAQYPGLNGLGLSIARLDLAPGGVVPFHTHPAASELLLVVQGTI VTGFVSSFANKVYLKKLVKGDLMVFPQGLLHFQINGGGKTAVAFASFSSPNPGLQITDFALFANDLPSALVEKTTFLDDAQVKKLKGVLGGTG* | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 13,972.170 | ||
| Theoretical pI: | 5.842 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 47.695 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.233 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335339.1 | 5prime_partial | 197 | 740-147(-) |
Amino Acid sequence : | |||
| QNALKTFTNHKQEKERVRNEEINHPVPPSTPLSFFTCASSKNVVFSTNADGKSFANSAKSVICKPGLGLLKLAKATAVFPPPLIWKCSSPCGNTIRSPFTSFFRYTLFANDDTNPVTMVP CTTRRSSDAAGWVWNGTTPPGAKSSRAIDSPSPLSPGYWASKAGVTAAPMMLVVLPPMRRPEKVKSATVTLAASLQE* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 13,972.170 | ||
| Theoretical pI: | 5.842 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 47.695 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.233 | ||
| sheet | 0.256 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335339.1 | complete | 129 | 483-94(-) |
Amino Acid sequence : | |||
| MQQPLREHHQVPLHQLLQVHLVRERRHESRDDGPLHHQEELRRRRVGVERHHTAGGQVQPRDRQPQPVKPWVLGVEGRGDGGADDVGGVAAHAEAGEGEVGDGDVGSVFAGVAGGARGEG EVCHAEVLD* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 13,972.170 | ||
| Theoretical pI: | 5.842 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5500 | ||
| Instability index: | 47.695 | ||
| aromaticity | 0.016 | ||
| GRAVY | -0.822 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.233 | ||
| sheet | 0.256 | ||