Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335341.1 | complete | 206 | 631-11(-) |
Amino Acid sequence : | |||
MILCFILSINPSWDTKSQLERGLEIRRFRASRLQLIMMIISRNQRPLIPQILCCVGLKEFPLRKRKNRLLQVHENPDPSPNMISAAAATAAVVVPTVKTFLKRQTGVLVAGVESLKRKSE ILGLKRRSLTRIIAETCKTAGWEKGFRRYKRRTIILIVAVVVIVGSDQFITTTTLRLGVVVERQIAGARVRIQAPATAAPPHSACQ* | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 21,956.635 | ||
Theoretical pI: | 6.038 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 69.588 | ||
aromaticity | 0.090 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.392 | ||
sheet | 0.196 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335341.1 | complete | 199 | 26-625(+) |
Amino Acid sequence : | |||
MRRRRRGRRLDSNPSSGDLALHHHPQSEGGCGYELIRPNNNNNSNDKDNCPSFVATESFFPTSSFAGFGNDPCQTSSFQAEDLGLSLQTFHSCNQNSGLPFQESFHGWNNNGGGGGGGGD HIGARVGVLMNLQQPIFPFSQRELLQSNAAQNLWNQRPLIPANNHHDQLEPRSSKSSNFETPFELGFRIPARIYGEDEA* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 21,956.635 | ||
Theoretical pI: | 6.038 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 69.588 | ||
aromaticity | 0.090 | ||
GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
Helix | 0.216 | ||
turn | 0.392 | ||
sheet | 0.196 |