| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335341.1 | complete | 206 | 631-11(-) |
Amino Acid sequence : | |||
| MILCFILSINPSWDTKSQLERGLEIRRFRASRLQLIMMIISRNQRPLIPQILCCVGLKEFPLRKRKNRLLQVHENPDPSPNMISAAAATAAVVVPTVKTFLKRQTGVLVAGVESLKRKSE ILGLKRRSLTRIIAETCKTAGWEKGFRRYKRRTIILIVAVVVIVGSDQFITTTTLRLGVVVERQIAGARVRIQAPATAAPPHSACQ* | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 21,956.635 | ||
| Theoretical pI: | 6.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 69.588 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.392 | ||
| sheet | 0.196 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335341.1 | complete | 199 | 26-625(+) |
Amino Acid sequence : | |||
| MRRRRRGRRLDSNPSSGDLALHHHPQSEGGCGYELIRPNNNNNSNDKDNCPSFVATESFFPTSSFAGFGNDPCQTSSFQAEDLGLSLQTFHSCNQNSGLPFQESFHGWNNNGGGGGGGGD HIGARVGVLMNLQQPIFPFSQRELLQSNAAQNLWNQRPLIPANNHHDQLEPRSSKSSNFETPFELGFRIPARIYGEDEA* | |||
Physicochemical properties | |||
| Number of amino acids: | 199 | ||
| Molecular weight: | 21,956.635 | ||
| Theoretical pI: | 6.038 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 69.588 | ||
| aromaticity | 0.090 | ||
| GRAVY | -0.854 | ||
Secondary Structure Fraction | |||
| Helix | 0.216 | ||
| turn | 0.392 | ||
| sheet | 0.196 | ||