| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335353.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
| HPVPSQFIVSQFGHGQSNPTFLLEAYSGHLKKQYVLRKKPPGKLLQSAHAVEREFQVLYALGTHTLVPVPKVYCLCTDTSFIGTAFYIMEYMEGRIFIEPMLRNVEPRQRRALYHATAKA LASLHSADVNVIGLQNYGKPNNYCKRQVERWTKQYLVSTGEGKSNRNPRMLELAEWLRQHIPSEDSSGATAGLVHGDFRIDNLVFHPTEDRVIGILDWELSTLGNQMCDVAYSCLHYIVD ISSDKIEENGG | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,407.056 | ||
| Theoretical pI: | 7.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
| Instability index: | 47.972 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.235 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335353.1 | internal | 251 | 2-754(+) |
Amino Acid sequence : | |||
| HPVPSQFIVSQFGHGQSNPTFLLEAYSGHLKKQYVLRKKPPGKLLQSAHAVEREFQVLYALGTHTLVPVPKVYCLCTDTSFIGTAFYIMEYMEGRIFIEPMLRNVEPRQRRALYHATAKA LASLHSADVNVIGLQNYGKPNNYCKRQVERWTKQYLVSTGEGKSNRNPRMLELAEWLRQHIPSEDSSGATAGLVHGDFRIDNLVFHPTEDRVIGILDWELSTLGNQMCDVAYSCLHYIVD ISSDKIEENGG | |||
Physicochemical properties | |||
| Number of amino acids: | 251 | ||
| Molecular weight: | 28,407.056 | ||
| Theoretical pI: | 7.299 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 34380 34630 | ||
| Instability index: | 47.972 | ||
| aromaticity | 0.096 | ||
| GRAVY | -0.325 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.235 | ||
| sheet | 0.243 | ||