| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335361.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
| ARRPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 23,431.110 | ||
| Theoretical pI: | 5.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.022 | ||
| GRAVY | 0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.295 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335361.1 | 5prime_partial | 227 | 717-34(-) |
Amino Acid sequence : | |||
| KQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGG AVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 23,431.110 | ||
| Theoretical pI: | 5.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.022 | ||
| GRAVY | 0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.295 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335361.1 | internal | 239 | 1-717(+) |
Amino Acid sequence : | |||
| ARRPFLTSNPALLAQPMALQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSA AVFAWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLL | |||
Physicochemical properties | |||
| Number of amino acids: | 239 | ||
| Molecular weight: | 23,431.110 | ||
| Theoretical pI: | 5.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.022 | ||
| GRAVY | 0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.295 | ||
| sheet | 0.339 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335361.1 | 5prime_partial | 227 | 717-34(-) |
Amino Acid sequence : | |||
| KQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAAARPPIEGPLGAPPVLLQGFALPGEDGG AVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAARGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 227 | ||
| Molecular weight: | 23,431.110 | ||
| Theoretical pI: | 5.012 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 42.633 | ||
| aromaticity | 0.022 | ||
| GRAVY | 0.036 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.295 | ||
| sheet | 0.339 | ||