| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335365.1 | internal | 191 | 574-2(-) |
Amino Acid sequence : | |||
| IKSCGIEYARQEMIKLVAAYMEEAKWCYSKYIPNMDEYMKLALVSGAYMMLATTSLVGILGDPITKQDFDWITSEPPILRAASVICRLMDDVVGHGIEQKISSVDCYMKENGCKKMEAVG EFSKRVKKAWKNLNEECVEPRAAGMVILVRVVNLARVINLLYVGEDSYGNSSVKTKELIKGVLVDPRKXSS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,271.756 | ||
| Theoretical pI: | 8.176 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 41.585 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.205 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335365.1 | internal | 191 | 574-2(-) |
Amino Acid sequence : | |||
| IKSCGIEYARQEMIKLVAAYMEEAKWCYSKYIPNMDEYMKLALVSGAYMMLATTSLVGILGDPITKQDFDWITSEPPILRAASVICRLMDDVVGHGIEQKISSVDCYMKENGCKKMEAVG EFSKRVKKAWKNLNEECVEPRAAGMVILVRVVNLARVINLLYVGEDSYGNSSVKTKELIKGVLVDPRKXSS | |||
Physicochemical properties | |||
| Number of amino acids: | 191 | ||
| Molecular weight: | 21,271.756 | ||
| Theoretical pI: | 8.176 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30285 | ||
| Instability index: | 41.585 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.038 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.205 | ||
| sheet | 0.284 | ||