Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | 5prime_partial | 252 | 820-62(-) |
Amino Acid sequence : | |||
PVRDVNFLRFCKQHAEGVWAVVDVSIDTIRETPGGAAFPNCRRLPSGCLVQDMPNGYSKVTWVEHVEYDESVVHQLYRPLVSSGMAFGAQRWIATLQRQCECLAILMSTVPARDHSAAIT AGGRRSMLKLAQRMTNNFCAGVCASSVHKWNKLRTENVDEDVQVMTRKSIDDPGEPPGIVLSAATSVWLPVSPQRLFDFLRDERLRSEWDILSNGGPMQEMAHIAKGQDHGNCVSLLRAS VSHYLPSIILIN* | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | 3prime_partial | 115 | 476-820(+) |
Amino Acid sequence : | |||
MISGRHGGHENGEALALALEGGDPALGTEGHAGGDEWPVKLVDDALVVLNVFHPSNLGIAIWHILYQAAGGEPPAIWKGCSARSFSDCVDRHIHHRPHAFRMLLAEPQEIHVPHR | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | complete | 114 | 780-436(-) |
Amino Acid sequence : | |||
MRKACGRWWMCRSTQSEKLRAEQPFQIAGGSPPAAWYKICQMAIPRLLGWNTLSTTRASSTSFTGHSSPPAWPSVPNAGSPPSNASASASPFSCPPCLPEIIPRRSLLAGGGAC* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | 5prime_partial | 252 | 820-62(-) |
Amino Acid sequence : | |||
PVRDVNFLRFCKQHAEGVWAVVDVSIDTIRETPGGAAFPNCRRLPSGCLVQDMPNGYSKVTWVEHVEYDESVVHQLYRPLVSSGMAFGAQRWIATLQRQCECLAILMSTVPARDHSAAIT AGGRRSMLKLAQRMTNNFCAGVCASSVHKWNKLRTENVDEDVQVMTRKSIDDPGEPPGIVLSAATSVWLPVSPQRLFDFLRDERLRSEWDILSNGGPMQEMAHIAKGQDHGNCVSLLRAS VSHYLPSIILIN* | |||
Physicochemical properties | |||
Number of amino acids: | 252 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | 3prime_partial | 115 | 476-820(+) |
Amino Acid sequence : | |||
MISGRHGGHENGEALALALEGGDPALGTEGHAGGDEWPVKLVDDALVVLNVFHPSNLGIAIWHILYQAAGGEPPAIWKGCSARSFSDCVDRHIHHRPHAFRMLLAEPQEIHVPHR | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY335367.1 | complete | 114 | 780-436(-) |
Amino Acid sequence : | |||
MRKACGRWWMCRSTQSEKLRAEQPFQIAGGSPPAAWYKICQMAIPRLLGWNTLSTTRASSTSFTGHSSPPAWPSVPNAGSPPSNASASASPFSCPPCLPEIIPRRSLLAGGGAC* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,088.753 | ||
Theoretical pI: | 9.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29365 | ||
Instability index: | 94.889 | ||
aromaticity | 0.079 | ||
GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
Helix | 0.193 | ||
turn | 0.386 | ||
sheet | 0.237 |