| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY335394.1 | 5prime_partial | 170 | 2-514(+) |
Amino Acid sequence : | |||
| TIGMVLPYLIGLIFRDRIHQWLKKWPQKAAMIRLAGEGSWFHQFKVVALFRVSPFPYTIFNYAIVVTSMRFWPYLWGSVAGMIPEAFIYIYSGRLIRTLANVQYRNYHLTPVEIVYNIIS FIVAIVTTIAFTIYARRTLDELKAAEAGSADELHKLPVEKCKTSFSLPPS* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,579.862 | ||
| Theoretical pI: | 9.711 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
| Instability index: | 29.128 | ||
| aromaticity | 0.153 | ||
| GRAVY | 0.334 | ||
Secondary Structure Fraction | |||
| Helix | 0.424 | ||
| turn | 0.188 | ||
| sheet | 0.241 | ||